Gene : LPX1

Symbol :	LPX1
Name/description :	Lpx1p Oleic acid-inducible, peroxisomal matrix localized lipase; transcriptionally activated by Yrm1p along with genes involved in multidrug resistance; peroxisomal import is dependent on the PTS1 receptor, Pex5p
Synonyms :
Organism :	Saccharomyces cerevisiae
Peroxisomal Localization :	GO: peroxisomal matrix Marcello Smith, et al.2002. J. Cell Biol. GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	YOR084W
Protein consensus sequence :	PTS1=0.0025; start position=376; end position=387; MEQNRFKKETKTCSASWPRAPQSTLCATDRLELTYDVYTSAERQRRSRTATRLNLVFLHGSGMSKVVWEYYLPRLVAADAEGNYAIDKVLLIDQVNHGDSAVRNRGRLGTNFNWIDGARDVLKIATCELGSIDSHPALNVVIGHSMGGFQALACDVLQPNLFHLLILIEPVVITRKAIGAGRPGLPPDSPQIPENLYNSLRLKTCDHFANESEYVKYMRNGSFFTNAHSQILQNIIDFERTKASGDDEDGGPVRTKMEQAQNLLCYMNMQTFAPFLISNVKFVRKRTIHIVGARSNWCPPQNQLFLQKTLQNYHLDVIPGGSHLVNVEAPDLVIERINHHIHEFVLTSPLQSSHIPQLTLEERAVMFDRAFDSFKNEALVKTTKQKL
Functional category(ies) :	Lipid metabolism Metabolism
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Blastp PsiBlast Alignment Phylogenetic tree [help] PhylomeDB
Gene Info:	Gene Summary (NCBI) Genome Browser (UCSC) Chromosomal Localization (NCBI) ENSEMBL SNPs (NCBI) Intron/Exon (Ace View: NCBI) Protein Properties (UCSC) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Sven Thoms, et al.2008. FEBS J. Lpx1p is a peroxisomal lipase required for normal peroxisome morphology. Eeva-Liisa Epple, et al.2003. J. Biol. Chem. Intravacuolar membrane lysis in Saccharomyces cerevisiae. Does vacuolar targeting of Cvt17/Aut5p affect its function? Dyer Dyer, et al.2002. Appl. Microbiol. Biotechnol. Metabolic engineering of Saccharomyces cerevisiae for production of novel lipid compounds. Wei-Pang Huang, et al.2002. Cell Struct. Funct. Autophagy in yeast: a review of the molecular machinery.