Gene : AT2G14860

Symbol :	AT2G14860
Name/description :	peroxisomal membrane protein 22 kDa, putative
Synonyms :	T26I20.2, T26I20_2
Organism :	Arabidopsis thaliana
Peroxisomal Localization :	GO: No Peroxisomal annotation GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	PXMP2
Protein consensus sequence :	MSRALFRNVAVDTARLIRRNAAASTDQYGKTGVAQSRPYFRSRQLLERAKETGVSPSPSLGFSSSSSPSRIGFVGWYLGMVKSHPVVTKSVTSSLIYIAADLSSQTIAKTSSESYDLVRTARMGGYGLFVLGPTLHYWFNFMSRLFPKQDLITTFKKMAMGQTIYGPIMTVIFFSLNASLQGERGSVILARLKRDLLPALFNGVMYWPLCDFITFRFFPVHLQPLVSNSFSYVWTIYMTYMANREKPVAIST
Functional category(ies) :	Peroxisomal membrane proteins (PMP) PXMP 2/4 family proteins
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Blastp PsiBlast Alignment Phylogenetic tree [help]
Gene Info:	Gene Summary (NCBI) Chromosomal Localization (NCBI) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Alison Murphy, et al.2003. Plant Physiol. Characterization of the targeting signal of the Arabidopsis 22-kD integral peroxisomal membrane protein. M Tugal, et al.1999. Plant Physiol. Arabidopsis 22-kilodalton peroxisomal membrane protein. Nucleotide sequence analysis and biochemical characterization.