Gene : PEX13

Symbol :	PEX13
Name/description :	peroxisomal biogenesis factor 13
Synonyms :	ZWS, NALD
Organism :	Homo sapiens
Peroxisomal Localization :	GO: peroxisomal membrane J Gould, et al.1996. J. Cell Biol. X Sacksteder, et al.2000. J. Cell Biol. Tam Nguyen, et al.2006. J. Cell. Sci. GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	PEX13
Protein consensus sequence :	MASQPPPPPKPWETRRIPGAGPGPGPGPTFQSADLGPTLMTRPGQPALTRVPPPILPRPSQQTGSSSVNTFRPAYSSFSSGYGAYGNSFYGGYSPYSYGYNGLGYNRLRVDDLPPSRFVQQAEESSRGAFQSIESIVHAFASVSMMMDATFSAVYNSFRAVLDVANHFSRLKIHFTKVFSAFALVRTIRYLYRRLQRMLGLRRGSENEDLWAESEGTVACLGAEDRAATSAKSWPIFLFFAVILGGPYLIWKLLSTHSDEVTDSINWASGEDDHVVARAEYDFAAVSEEEISFRAGDMLNLALKEQQPKVRGWLLASLDGQTTGLIPANYVKILGKRKGRKTVESSKVSKQQQSFTNPTLTKGATVADSLDEQEAAFESVFVETNKVPVAPDSIGKDGEKQDL
Functional category(ies) :	Peroxisome biogenesis (peroxins) Peroxisome docking
Disease(s) :	Zellweger syndrome Neonatal adrenoleukodystrophy
Comparative genomics:	PTS prediction Blastp PsiBlast Alignment Phylogenetic tree [help] PhylomeDB
Gene Info:	Gene Summary (NCBI) Genome Browser (UCSC) Chromosomal Localization (NCBI) ENSEMBL SNPs (NCBI) Intron/Exon (Ace View: NCBI) Gene Expression (UCSC) Protein Properties (UCSC) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Cindy Krause, et al.2006. Hum. Mutat. Identification of novel mutations in PEX2, PEX6, PEX10, PEX12, and PEX13 in Zellweger spectrum patients. Marc Fransen, et al.2004. J. Biol. Chem. Potential role for Pex19p in assembly of PTS-receptor docking complexes. Jones Jones, et al.2001. J. Cell Biol. Multiple distinct targeting signals in integral peroxisomal membrane proteins. P Barnett, et al.2000. EMBO J. The peroxisomal membrane protein Pex13p shows a novel mode of SH3 interaction. N Shimozawa, et al.1999. Hum. Mol. Genet. Nonsense and temperature-sensitive mutations in PEX13 are the cause of complementation group H of peroxisome biogenesis disorders.