Gene : Pex13

Symbol :	Pex13
Name/description :	peroxisomal biogenesis factor 13
Synonyms :	2610008O20Rik
Organism :	Mus musculus
Peroxisomal Localization :	GO: peroxisome Jonas Björkman, et al.2002. Genomics Megan Maxwell, et al.2003. Mol. Cell. Biol. Miki Kikuchi, et al.2004. J. Biol. Chem. Tam Nguyen, et al.2006. J. Cell. Sci. GFP: No experiment found Mass Spectrometry: Miki Kikuchi, et al.2004. J. Biol. Chem. PeroxisomeDB annotation
Protein family :	PEX13
Protein consensus sequence :	MASQPPPPPKPWESRRIPGAGPGPGSGPGPTYQSADLGPTLLTRPGQPTLTRVPPPILPRPSQQTGSNNVNTFRPAYSSFSSGYGAYGNSFYGSYSPYSYGYNGLGFNRLRVDDLPPSRFVQQAEESSRGAFQSIESIVHAFASVSMMMDATFSAVYNSFRAVLDVANHFSRLKIHFTKVFSAFALVRTIRYLYRRLQWMMGLRRGSENEDLWAESEGTVACLSAEDQATNSAKSWPIFLFFAVILGGPYLIWKLLSTHNDEVTDNTNWASGEDDHVVARAEYDFVAVSDEEISFRAGDMLNLALKEQQPKVRGWLLASLDGQTTGLIPANYVKILGKRRGRKTIESSTMLKQQQSFTNPTLIKGVTTTNPLDEQEAAFESVFVETNKVSSAPDSTGKNGDKQDL
Functional category(ies) :	Peroxisome biogenesis (peroxins) Peroxisome docking
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Alignment Phylogenetic tree [help]
Gene Info:	Gene Summary (NCBI) Genome Browser (UCSC) Chromosomal Localization (NCBI) ENSEMBL Protein Properties (UCSC) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Ryota Itoh, et al.2006. J. Biol. Chem. Functional domains and dynamic assembly of the peroxin Pex14p, the entry site of matrix proteins. Tam Nguyen, et al.2006. J. Cell. Sci. Failure of microtubule-mediated peroxisome division and trafficking in disorders with reduced peroxisome abundance. Ben Geuze, et al.2003. Mol. Biol. Cell Involvement of the endoplasmic reticulum in peroxisome formation. Jonas BjÃ¶rkman, et al.2002. Genomics Pex13, the mouse ortholog of the human peroxisome biogenesis disorder PEX13 gene: gene structure, tissue expression, and localization of the protein to peroxisomes. J BjÃ¶rkman, et al.1998. Genomics Genomic structure of PEX13, a candidate peroxisome biogenesis disorder gene.