Gene : XP_824290

Symbol :	XP_824290
Name/description :	XP_824290
Synonyms :
Organism :	Trypanosoma brucei
Peroxisomal Localization :	GO: No Peroxisomal annotation GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	PEX7
Protein consensus sequence :	MPSFVLHPGFAGHSLRCNPWQPTQFLVTASEHFGVAGSGKVYVVNTSQGLQPHSPVQLVGCWGTSDAAFDACFSEVDRDLVAVACGDGVKLYSLQQSFNRDGVMPVAHSTEHRAEVVGVAWCRDAFLSCSWDGAVKLWKAATPQVSFMTFHEHLKEVYEVSCSTFNPASFLSCSGDGTWRLWDSRSPRSVLTQIGHGHQPILSIDFNKQDNSIFATGGVDRTVHLWDVRRPQRPLTVLPGHDNACRRVRFSPHSRTLLASSGYDCRVCLWDLNQPQRPLTARYAHHREFVVGLQWSLATPNALASVSWDGSAFFWTNGQPLTPSPSSQPLPPAIPPPRVRPPRPKGVPDISALPLTVPPVR
Functional category(ies) :	Peroxisome biogenesis (peroxins) Peroxisome targeting sequence binding
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Blastp PsiBlast Alignment Phylogenetic tree [help]
Gene Info:	No banks found
Pubmed:	Nathalie Galland, et al.2007. Biochim. Biophys. Acta Characterization of the role of the receptors PEX5 and PEX7 in the import of proteins into glycosomes of Trypanosoma brucei. Jungwoo Choe, et al.2003. Biochemistry Analysis of the sequence motifs responsible for the interactions of peroxins 14 and 5, which are involved in glycosome biogenesis in Trypanosoma brucei.