Gene : Tc00.1047053509203.40

Symbol :	Tc00.1047053509203.40
Name/description :	glycosomal membrane protein
Synonyms :
Organism :	Trypanosoma cruzi
Peroxisomal Localization :	GO: No Peroxisomal annotation GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	PEX11
Protein consensus sequence :	MSDFDKFVKLLGQTDGRDKIYKFIGGVLKALAALDAVECRRSAYKSVSSSITDGRSLMRMAKWMGDIPKMRSVFAKCAEGGRMELTALIVLLRVLGNFLYILGDNVAFLMRYKLVPGQPKRVQYHSKVSQFWGFFFAAVLDLLALRTALQKRASDAATSCKEAKSALINLTKDASDVLVTMAAVGYMKGVWHPGPVTAGALTAVSGGVATYLNWKKIK
Functional category(ies) :	Peroxisome biogenesis (peroxins) Peroxisome division-proliferation
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Alignment Phylogenetic tree [help]
Gene Info:	Gene Summary (NCBI) Chromosomal Localization (NCBI) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Frank Voncken, et al.2003. J. Biol. Chem. Depletion of GIM5 causes cellular fragility, a decreased glycosome number, and reduced levels of ether-linked phospholipids in trypanosomes. P Lorenz, et al.1998. EMBO J. Elongation and clustering of glycosomes in Trypanosoma brucei overexpressing the glycosomal Pex11p.