Protein familiy: FIS1

Organism : Takifugu rubripes
Protein family description: Mitochondrial and peroxisomal protein involved in membrane fission, required for localization of Dnm1p and Mdv1p during mitochondrial division.
Gene Description Genome localization
NEWSINFRUG00000131160 Claudin 15a. [Source:Uniprot/SPTREMBL;Acc:Q6E5S2] scaffold_63: 1155728-1156570

FIS1 sequence(s) for Takifugu rubripes and PTS predictions

  • NEWSINFRUG00000131160 
     Non-significant PTS1, PTS2, PEX19 prediction reported
    		•

    MDPIVEVVAFVLGFLGWVMVGVCLPNRYWRTSTVDGNVITTSTIYENLWMSCATDSTGVHNCREFPSLLALNGYIQASRALMITSIVLGTFGLVAA
    LIGIQCSKAGGENYALKGKIAGTAGVLFILQGLCTMIAISWYAFNITQEFFDPFFPGTKYEIGEGLYIGWCSSVLAIAGGACLVCSCKVGGEEKQ