Protein familiy: PEX17

Organism : Saccharomyces cerevisiae
Protein family description: Peroxisomal membrane protein component of the peroxisomal translocation machinery, required for peroxisome biogenesis, binds Pex14p.
Gene Description Genome localization
PEX17 Peroxisomal membrane protein component of the peroxisomal translocation machinery, required for peroxisome biogenesis, binds Pex14p. [Source:Saccharomyces Genome Database;Acc:S000005158] XIV: 245616-246215

PEX17 sequence(s) for Saccharomyces cerevisiae and PTS predictions

  • PEX17
    PEX19=0.035; start position=77; end position=86;
    PEX19=0.037; start position=66; end position=75;

  • MTSINSFPRNIDWPSNIGIKKIEGTNPTVNAIKGLLYNGGSIYAFLYFVIAMFVEPTLQKQYQQRNDFSLFVLLRLRRIIAQLQKRLVMTPVSSLG
    FNEQNNFVERSTQTSDDNIIREDNSHWAEMIYQLQNMKQELQYFNRSSGQPSESIDDFVFQIKMVTDQVELTDRSRAFSNKSRNIIQGIREIKGWF
    VNGQVPR