Protein familiy: PEX18-21

Organism : Saccharomyces cerevisiae
Protein family description: Part of a two-member peroxin family (Pex18p and Pex21p) specifically required for peroxisomal targeting of the Pex7p peroxisomal signal recognition factor and PTS2 peroxisomal matrix proteins.
Gene Description Genome localization
PEX21 Part of a two-member peroxin family (Pex18p and Pex21p) specifically required for peroxisomal targeting of the Pex7p peroxisomal signal recognition factor and PTS2-type peroxisomal matrix proteins. [Source:Saccharomyces Genome Database;Acc:S000003471] VII: 969192-970058
PEX18 Part of a two-member peroxin family (Pex18p and Pex21p) specifically required for peroxisomal targeting of the Pex7p peroxisomal signal recognition factor and PTS2 peroxisomal matrix proteins. [Source:Saccharomyces Genome Database;Acc:S000001203] VIII: 419223-420074

PEX18-21 sequence(s) for Saccharomyces cerevisiae and PTS predictions

  • PEX21 
     Non-significant PTS1, PTS2, PEX19 prediction reported
    		•

    MPSVCHTSPIEKIIQQGHRIQNDSLIPSKRTKLAHTELTAHYATEDSHVEKHFLHNGSNFDGIDNVRYQNQPSPLTFITPNNTVDSSDWVPQFSSM
    KIDDSLEFSSEYKRLYSNYESQQRLNSSRQHLPFKNCMIRKTSCTYPPQKTLRQQRQGNRDNPTDAFQFDAEFQVLEREIQKERYEPITRRDEKWF
    DQDQSELQRIATDIVKCCTPPPSSASSSSTLSSSVESKLSESKFIQLMRNISSGDVTLKKNADGNSASELFSSNNGELVGNRHIFVKDEIHKDILD
  • PEX18 
     Non-significant PTS1, PTS2, PEX19 prediction reported
    		•

    MNSNRCQTNEVNKFISSTEKGPFTGRDNTLSFNKIGSRLNSPPILKDKIELKFLQHSEDLNQSRSYVNIRPRTLEDQSYKFEAPNLNDNETSWAKD
    FRYNFPKNVEPPIENQIANLNINNGLRTSQTDFPLGFYSQKNFNIASFPVVDHQIFKTTGLEHPINSHIDSLINAEFSELEASSLEEDVHTEEENS
    GTSLEDEETAMKGLASDIIEFCDNNSANKDVKERLNSSKFMGLMGSISDGSIVLKKDNGTERNLQKHVGFCFQNSGNWAGLEFHDVEDRIA