Organism : | Saccharomyces cerevisiae | ||
Protein family description: | Part of a two-member peroxin family (Pex18p and Pex21p) specifically required for peroxisomal targeting of the Pex7p peroxisomal signal recognition factor and PTS2 peroxisomal matrix proteins. | ||
Gene | Description | Genome localization | |
PEX21 | Part of a two-member peroxin family (Pex18p and Pex21p) specifically required for peroxisomal targeting of the Pex7p peroxisomal signal recognition factor and PTS2-type peroxisomal matrix proteins. [Source:Saccharomyces Genome Database;Acc:S000003471] | VII: 969192-970058 | |
PEX18 | Part of a two-member peroxin family (Pex18p and Pex21p) specifically required for peroxisomal targeting of the Pex7p peroxisomal signal recognition factor and PTS2 peroxisomal matrix proteins. [Source:Saccharomyces Genome Database;Acc:S000001203] | VIII: 419223-420074 |
PEX18-21 sequence(s) for Saccharomyces cerevisiae and PTS predictions
Non-significant PTS1, PTS2, PEX19 prediction reported |
MPSVCHTSPIEKIIQQGHRIQNDSLIPSKRTKLAHTELTAHYATEDSHVEKHFLHNGSNFDGIDNVRYQNQPSPLTFITPNNTVDSSDWVPQFSSM KIDDSLEFSSEYKRLYSNYESQQRLNSSRQHLPFKNCMIRKTSCTYPPQKTLRQQRQGNRDNPTDAFQFDAEFQVLEREIQKERYEPITRRDEKWF DQDQSELQRIATDIVKCCTPPPSSASSSSTLSSSVESKLSESKFIQLMRNISSGDVTLKKNADGNSASELFSSNNGELVGNRHIFVKDEIHKDILD |
Non-significant PTS1, PTS2, PEX19 prediction reported |
MNSNRCQTNEVNKFISSTEKGPFTGRDNTLSFNKIGSRLNSPPILKDKIELKFLQHSEDLNQSRSYVNIRPRTLEDQSYKFEAPNLNDNETSWAKD FRYNFPKNVEPPIENQIANLNINNGLRTSQTDFPLGFYSQKNFNIASFPVVDHQIFKTTGLEHPINSHIDSLINAEFSELEASSLEEDVHTEEENS GTSLEDEETAMKGLASDIIEFCDNNSANKDVKERLNSSKFMGLMGSISDGSIVLKKDNGTERNLQKHVGFCFQNSGNWAGLEFHDVEDRIA |