| Organism : | Saccharomyces cerevisiae | ||
| Protein family description: | Nicotinamidase that converts nicotinamide to nicotinic acid as part of the NAD(+) salvage pathway, required for life span extension by calorie restriction. | ||
| Gene | Description | Genome localization | |
| PNC1 | Nicotinamidase that converts nicotinamide to nicotinic acid as part of the NAD(+) salvage pathway, required for life span extension by calorie restriction; PNC1 expression responds to all known stimuli that extend replicative life span. [Source:Saccharomy | VII: 427303-427953 | |
PNC1 sequence(s) for Saccharomyces cerevisiae and PTS predictions
Non-significant PTS1, PTS2, PEX19 prediction reported |
|
MKTLIVVDMQNDFISPLGSLTVPKGEELINPISDLMQDADRDWHRIVVTRDWHPSRHISFAKNHKDKEPYSTYTYHSPRPGDDSTQEGILWPVHCV KNTWGSQLVDQIMDQVVTKHIKIVDKGFLTDREYYSAFHDIWNFHKTDMNKYLEKHHTDEVYIVGVALEYCVKATAISAAELGYKTTVLLDYTRPI SDDPEVINKVKEELKAHNINVVDK |