Protein familiy: PRDX5

Organism : Saccharomyces cerevisiae
Protein family description: Peroxiredoxin 5
Gene Description Genome localization
AHP1 Thiol-specific peroxiredoxin, reduces hydroperoxides to protect against oxidative damage; function in vivo requires covalent conjugation to Urm1p. [Source:Saccharomyces Genome Database;Acc:S000004099] XII: 368782-369312

PRDX5 sequence(s) for Saccharomyces cerevisiae and PTS predictions

  • AHP1
    PTS1=0.047; start position=165; end position=176;

  • MSDLVNKKFPAGDYKFQYIAISQSDADSESCKMPQTVEWSKLISENKKVIITGAPAAFSPTCTVSHIPGYINYLDELVKEKEVDQVIVVTVDNPFA
    NQAWAKSLGVKDTTHIKFASDPGCAFTKSIGFELAVGDGVYWSGRWAMVVENGIVTYAAKETNPGTDVTVSSVESVLAHL