Protein familiy: PXMP2

Organism : Apis mellifera
Protein family description: Peroxisomal membrane protein (PMP22) is a major component of peroxisomal membranes. PMP22 seems to be involved in pore forming activity and may contribute to the unspecific permeability of the organelle membrane.
Gene Description Genome localization
LOC551171 NULL Group3: 8924312-8925636

PXMP2 sequence(s) for Apis mellifera and PTS predictions

  • LOC551171 
     Non-significant PTS1, PTS2, PEX19 prediction reported
    		•

    MALSKPKNLILQLTSAYFERLYTSPVKTKAITSCIIATLGNFLSQKISGVKHLNEDSLLAFALFGLIFGGPLPHYFYTYIQLFVRNPLMLLLVERC
    LYTPCYQALALYMLSLFEGNTHKDACKQMKSLYWPVIIANLKYLTLLQFINLKYVPPILRVLVVNLIGFFWAIYLAQQRSKQSKITGIKK