| Organism : | Canis familiaris | ||
| Protein family description: | Peroxisomal membrane protein (PMP22) is a major component of peroxisomal membranes. PMP22 seems to be involved in pore forming activity and may contribute to the unspecific permeability of the organelle membrane. | ||
| Gene | Description | Genome localization | |
| PXMP2 | PREDICTED: similar to Peroxisomal membrane protein 2 (22 kDa peroxisomal membrane protein) [Source:RefSeq_peptide;Acc:XP_543347] | 26: 3422007-3430281 | |
PXMP2 sequence(s) for Canis familiaris and PTS predictions
Non-significant PTS1, PTS2, PEX19 prediction reported |
|
SVHSGILSALGNFLAQMIEKKREKENCSQKLDVSGPLRYAIYGFFFTGPLNHFFYLFMEHWIPPEVPLAGVKRLLLDRLLFAPAFLLLFFLIMNFL EGRETAAFAVQIRRSFWPALCMNWRVWTPVQFININYVPLQFRVLFANLVSLFWYIYLASLGK |