| Organism : | Ciona intestinalis | ||
| Protein family description: | Peroxisomal membrane protein (PMP22) is a major component of peroxisomal membranes. PMP22 seems to be involved in pore forming activity and may contribute to the unspecific permeability of the organelle membrane. | ||
| Gene | Description | Genome localization | |
| LOC100176969 | NULL | scaffold_26: 987673-1005369 | |
PXMP2 sequence(s) for Ciona intestinalis and PTS predictions
PEX19=0.081; start position=123; end position=132;
|
|
MAVRLVGWYTRMFNKRPVVTQVITAGTLTTSGDIIAQLIENRPTGYSFRRTAVMSCFGFCYFGPLVTVWLGFLKRLNLSVIRTVMLDQAVFAPLIN GGFVFLHPILSNKGTNEACRIFSENSWNVIRSCWMLWIPAQLINFSFVPFKYRMIYIQVVALFWNAFLSFRSNSAIQK |