| Organism : | Cryptococcus neoformans | ||
| Protein family description: | Peroxisomal membrane protein (PMP22) is a major component of peroxisomal membranes. PMP22 seems to be involved in pore forming activity and may contribute to the unspecific permeability of the organelle membrane. | ||
| Gene | Description | Genome localization | |
| CNA06860 | 1 | ||
PXMP2 sequence(s) for Cryptococcus neoformans and PTS predictions
Non-significant PTS1, PTS2, PEX19 prediction reported |
|
MAGLMGKYAAFLTRRPVLGNMISSAVLFGTGDVIAQQLIEKKGADHDLPRTARIVTWGGILFAPTVNLWFRTLERIPIRSRWPATFARVGLDQFGF APVILSGFFTAMTFMEGKDFNAAKVKWHESFFPTLQANWMLFIPFQILNMLVPLQYRLLAVNAVNIPWNAFLSLQNAKGRKAEEDPVAISKKE |