Protein familiy: PXMP2

Organism : Debaryomyces hansenii
Protein family description: Peroxisomal membrane protein (PMP22) is a major component of peroxisomal membranes. PMP22 seems to be involved in pore forming activity and may contribute to the unspecific permeability of the organelle membrane.
Gene Description Genome localization
DEHA0F02024g F

PXMP2 sequence(s) for Debaryomyces hansenii and PTS predictions

  • DEHA0F02024g 
     Non-significant PTS1, PTS2, PEX19 prediction reported
    		•

    MASIYQKYSQLIAKRPLITNIITTGFLFGSGDYLAQTLYPSSSKYDYKRTLRATFYGSIIFAPIGDKWYRLLHKINFPFPKTKVSPTVSKVLNTLT
    KVGVDQLVFAPFIGIPLYYSVMSVLEFHDNPLQVAREKLHAHWFNTLKTNWVVWPTFQLFNFALIPVQFRLLVVNIFSIGWNCYLSSVLNHKHDFL
    IENITDVDKDEILI