| Organism : | Drosophila melanogaster | ||
| Protein family description: | Peroxisomal membrane protein (PMP22) is a major component of peroxisomal membranes. PMP22 seems to be involved in pore forming activity and may contribute to the unspecific permeability of the organelle membrane. | ||
| Gene | Description | Genome localization | |
| CG7970 | NULL | 3L: 1636537-1637642 | |
PXMP2 sequence(s) for Drosophila melanogaster and PTS predictions
PEX19=0.0024; start position=85; end position=94;
PEX19=0.063; start position=139; end position=148;
|
|
MVLSKPLYSLFGTYLEQLFNHPVRTKSITACVLATSANVTSQRLAGAKTLNQQSVFAYGLFGLIFGGSVPHYFYTTVERLFSQDVRFRRFFLFLSE RLVYAPIYQALSLFFLALFEGKSPSTALKNVEKLYWPLLKANWQYLSVFVYLNFAYVPPMFRSISMAIISFIWVVYIAQKRRRFQDKLAAKEAAK |