Protein familiy: PXMP2

Organism : Kluyveromyces lactis
Protein family description: Peroxisomal membrane protein (PMP22) is a major component of peroxisomal membranes. PMP22 seems to be involved in pore forming activity and may contribute to the unspecific permeability of the organelle membrane.
Gene Description Genome localization
KLLA0F22924g F

PXMP2 sequence(s) for Kluyveromyces lactis and PTS predictions

  • KLLA0F22924g 
     Non-significant PTS1, PTS2, PEX19 prediction reported
    		•

    MNGFVNWYTASVKRSPRLTNGIMTGSLFGIGDVIAQVGFPEKKGQKYDLARTVRAVVYGSLIFSIIGDSWYKFLNQKVIVKPGKHWTNTAARVGCD
    QLLFAPVGIPMYYGVMSILEGKSLVDAKKKIEDNWWPTLVTNWYVWPAFQLINFSLVPVHHRLFSVNIISIFWNAFLSFKNSISPSDKKVPVNFPP
    VPE