| Organism : | Mus musculus | ||
| Protein family description: | Peroxisomal membrane protein (PMP22) is a major component of peroxisomal membranes. PMP22 seems to be involved in pore forming activity and may contribute to the unspecific permeability of the organelle membrane. | ||
| Gene | Description | Genome localization | |
| Pxmp2 | peroxisomal membrane protein 2 [Source:MarkerSymbol;Acc:MGI:107487] | 5: 109440818-109452544 | |
PXMP2 sequence(s) for Mus musculus and PTS predictions
Non-significant PTS1, PTS2, PEX19 prediction reported |
|
MAPAASRLRVESELGSLPKRALAQYLLLLKLYPVLTKAVSSGILSALGNLLAQTIEKRKKDSQNLEVSGLLRYLVYGLFVTGPLSHYLYLFMEYSV PPEVPWASVKRLLLDRLFFAPTFLLLFFFVMNLLEGKNVSVFVAKMRSGFWPALQMNWRMWTPLQFININYVPLQFRVLFANMAALFWYAYLASLG K |