Protein familiy: PXMP2

Organism : Oryza sativa
Protein family description: Peroxisomal membrane protein (PMP22) is a major component of peroxisomal membranes. PMP22 seems to be involved in pore forming activity and may contribute to the unspecific permeability of the organelle membrane.
Gene Description Genome localization
Os08g0566900

PXMP2 sequence(s) for Oryza sativa and PTS predictions

  • Os08g0566900 
     Non-significant PTS1, PTS2, PEX19 prediction reported
    		•

    MSDVVAMAGQAYMRQLQAHPLRTKAITSGVLAGCSDAIAQKISGVPNLQRRRLLLIMLYGFAYAGPFGHFLHKLMDRFFKGKKGKETTAKKVLVEQ
    LTASPWNNMMFMMYYGLVVEGRPFSQVKSKLKKDYASVQLTAWKFWPIVSWINYEYMPLQLRVLFHSFVASCWAVFLNLKAARSIATSKKA