| Organism : | Takifugu rubripes | ||
| Protein family description: | Peroxisomal membrane protein (PMP22) is a major component of peroxisomal membranes. PMP22 seems to be involved in pore forming activity and may contribute to the unspecific permeability of the organelle membrane. | ||
| Gene | Description | Genome localization | |
| NEWSINFRUG00000145991 | Homolog of Homo sapiens "Peroxisomal membrane protein 2 [Source:IPI;Acc:IPI00221002]" | scaffold_50: 742108-743301 | |
PXMP2 sequence(s) for Takifugu rubripes and PTS predictions
Non-significant PTS1, PTS2, PEX19 prediction reported |
|
RLLQQYLFLLKRYPIITKSVTSGILTALGNLLSQNLEARKKAGAIDGTGVARYAVYGLFITGPVSHCFYQLMEALIPTTDPHCIIKRLLLDRLIFA PGFLLIFYFVMNILEFKGWEEFEKKLKGSFWTALKMNWKVWTPFQFVNINFVPVQFRVLFANMVALFWYAYLASVRK |