Protein familiy: PXMP2

Organism : Tetraodon nigroviridis
Protein family description: Peroxisomal membrane protein (PMP22) is a major component of peroxisomal membranes. PMP22 seems to be involved in pore forming activity and may contribute to the unspecific permeability of the organelle membrane.
Gene Description Genome localization
GSTENG00029514001 NULL 12: 6432941-6434401

PXMP2 sequence(s) for Tetraodon nigroviridis and PTS predictions

  • GSTENG00029514001 
     Non-significant PTS1, PTS2, PEX19 prediction reported
    		•

    RLLQQYLFLLRKYPILTKSVTSGILTALGNLLSQSLEARKKASNDAICGPAVARYAAYGLFITGPVSHCFYQLMEALIPATDPHCIIKRLLLDRLF
    FAPGFLLIFYLVMNVLELKGWKELEAKLKGSFWTALKMNWKVWTPFQFVNINFVPVQFRVLFANVVALFWYAYLASVRK