Protein familiy: PXMP2

Organism : Xenopus tropicalis
Protein family description: Peroxisomal membrane protein (PMP22) is a major component of peroxisomal membranes. PMP22 seems to be involved in pore forming activity and may contribute to the unspecific permeability of the organelle membrane.
Gene Description Genome localization
pxmp2 Peroxisomal membrane protein 2, 22kDa. [Source:Uniprot/SPTREMBL;Acc:Q6DDB4] scaffold_91: 1106254-1111537

PXMP2 sequence(s) for Xenopus tropicalis and PTS predictions

  • pxmp2
    PEX19=0.089; start position=16; end position=25;

  • MPVASKPVPGRAPLHTVLLLRYLQLLHSRPVLTKALTSAILSALGNILSQTIQKWRKEQKHPQNVDLRGPLRFAVYGLLFTGPLSHYFYLLLEQLV
    PSSAPLAGLQRLLIERLIIAPAFLLLFFLVMNLLEGKNFTKLNQKLKSSYWQALKLNWKVWTPFQFININYVPVQFRVLFANLVAFFWYAYLSSTR
    N