Protein familiy: Pex15

Organism : Saccharomyces cerevisiae
Protein family description: Phosphorylated tail-anchored type II integral peroxisomal membrane protein required for peroxisome biogenesis, cells lacking Pex15p mislocalize peroxisomal matrix proteins to cytosol, overexpression results in impaired peroxisome assembly.
Gene Description Genome localization
PEX15 Phosphorylated tail-anchored type II integral peroxisomal membrane protein required for peroxisome biogenesis, cells lacking Pex15p mislocalize peroxisomal matrix proteins to cytosol, overexpression results in impaired peroxisome assembly. [Source:Sacchar XV: 247148-248299

Pex15 sequence(s) for Saccharomyces cerevisiae and PTS predictions

  • PEX15
    PEX19=0.0012; start position=136; end position=145;
    PEX19=0.016; start position=337; end position=346;
    PEX19=0.058; start position=340; end position=349;
    PEX19=0.066; start position=370; end position=379;

  • MAASEIMNNLPMHSLDSSLRDLLNDDLFIESDESTKSVNDQRSEVFQECVNLFIKRDIKDCLEKMSEVGFIDITVFKSNPMILDLFVSACDIMPSF
    TKLGLTLQSEILNIFTLDTPQCIETRKIILGDLSKLLVINKFFRCCIKVIQFNLTDHTEQEEKTLELESIMSDFIFVYITKMRTTIDVVGLQELIE
    IFIFQVKVKLHHKKPSPNMYWALCKTLPKLSPTLKGLYLSKDVSIEDAILNSIDNKIQKDKAKSKGKQRGVKQKIHHFHEPMLHNSSEEQVKVEDA
    FNQRTSTDSRLQSTGTAPRKKNNDITVLAGSFWAVLKHHFTRSVLNKNGLLLTGLLLLLCLKKYKSLMAIFKHVPAAFHTVYPQIVGLLKLLASI