| Organism : | Saccharomyces cerevisiae | ||
| Protein family description: | Rho-related GTP-binding protein RhoC (H9). | ||
| Gene | Description | Genome localization | |
| RHO1 | GTP-binding protein of the rho subfamily of Ras-like proteins, involved in establishment of cell polarity; regulates protein kinase C (Pkc1p) and the cell wall synthesizing enzyme 1,3-beta-glucan synthase (Fks1p and Gsc2p). [Source:Saccharomyces Genome Da | XVI: 875364-875993 | |
RHO1 sequence(s) for Saccharomyces cerevisiae and PTS predictions
Non-significant PTS1, PTS2, PEX19 prediction reported |
|
MSQQVGNSIRRKLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADVEVDGRRVELALWDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDS LENVQEKWIAEVLHFCQGVPIILVGCKVDLRNDPQTIEQLRQEGQQPVTSQEGQSVADQIGATGYYECSAKTGYGVREVFEAATRASLMGKSKTNG KAKKNTTEKKKKKCVLL |