| Organism : | Arabidopsis thaliana | ||
| Protein family description: | Peroxisomal membrane protein PEX16 (Peroxin-16) (Peroxisomal biogenesis factor 16). | ||
| Gene | Description | Genome localization | |
| SSE1 | Encodes a protein with similarity to yeast Pep16p, a membrane localized gene involved in peroxisome assembly and protein-traffiking. SSE1 mutant seeds do not accumulate oils and dessicated seeds have a shrunken appearance. Involved in protein and oil body biogenesis. SSE is expressed during seed development, reaching the highest peak in mature siliques. Expression in leaves and roots is low compared to cotyledons and flowers. SHRUNKEN SEED 1(full_name) SSE(symbol) Encodes a protein with similarity to yeast Pep16p, a membrane localized gene involved in peroxisome assembly and protein-traffiking. SSE1 mutant seeds do not accumulate oils and dessicated seeds have a shrunken appearance. Involved in protein and oil body biogenesis. SSE is expressed during seed development, reaching the highest peak in mature siliques. Expression in leaves and roots is low compared to cotyledons and flowers. SHRUNKEN SEED 1(full_name) SSE(symbol) | ||
PEX16 sequence(s) for Arabidopsis thaliana and PTS predictions
Non-significant PTS1, PTS2, PEX19 prediction reported |
|
MEAYKQWVWRNREYVQSFGSFANGLTWLLPEKFSASEIGPEAVTAFLGIFSTINEHIIENAPTPRGHVGSSGNDPSLSYPLLIAILKDLETVVEVA AEHFYGDKKWNYIILTEAMKAVIRLALFRNSGYKMLLQGGETPNEEKDSNQSESQNRAGNSGRNLGPHGLGNQNHHNPWNLEGRAMSALSSFGQNA RTTTSSTPGWSRRIQHQQAVIEPPMIKERRRTMSELLTEKGVNGALFAIGEVLYITRPLIYVLFIRKYGVRSWIPWAISLSVDTLGMGLLANSKWW GEKSKQVHFSGPEKDELRRRKLIWALYLMRDPFFTKYTRQKLESSQKKLELIPLIGFLTEKIVELLEGAQSRYTYISGS |