| Organism : | Bos taurus | ||
| Protein family description: | Peroxisomal membrane protein (PMP22) is a major component of peroxisomal membranes. PMP22 seems to be involved in pore forming activity and may contribute to the unspecific permeability of the organelle membrane. | ||
| Gene | Description | Genome localization | |
| PXMP2 | Peroxisomal membrane protein 2 (22 kDa peroxisomal membrane protein). [Source:Uniprot/SWISSPROT;Acc:Q9NR77] [from human gene ENSG00000176876] | 17: 23109253-23118991 | |
PXMP2 sequence(s) for Bos taurus and PTS predictions
Non-significant PTS1, PTS2, PEX19 prediction reported |
|
MAPAASKLRAEAGLGPLPRRALSQYLRLLRLYPVLTKAATSGILSALGNFLAQLIEKKQKKENCSQKLDVSGPLRYAIYGFFFTGPLGHFFYLLME RWIPSEVPLAGIKRLLLDRLLFAPAFLSLFFLVMNFLEGQDTAAFAAKMKSGFWPALRMNWRVWTPVQFININYIPVQFRVLFANLVALFWYAYLA SLGK |