| Organism : | Danio rerio | ||
| Protein family description: | Peroxisomal membrane protein (PMP22) is a major component of peroxisomal membranes. PMP22 seems to be involved in pore forming activity and may contribute to the unspecific permeability of the organelle membrane. | ||
| Gene | Description | Genome localization | |
| zgc:92599 | zgc:92599 [Source:RefSeq_peptide;Acc:NP_001004607] | 5: 10292094-10299322 | |
PXMP2 sequence(s) for Danio rerio and PTS predictions
Non-significant PTS1, PTS2, PEX19 prediction reported |
|
MPTQSVLVRDPSLLARALQQYLSLLKKYPIITKSVTSGILSALGNLLSQVLEYQKNVKENSPKKKISILGPVHFAIYGLFITGPVSHYFYHLLEVL LPTTVPYCLIKRLLLERLIFAPAFLLLFYVVMNALEGKTLADVQNKLKTSYWPAMKMNWKVWTPFQFININYVPVQFRVLFANMVALFWYAYLASV RK |