Protein familiy: PXMP2

Organism : Macaca mulatta
Protein family description: Peroxisomal membrane protein (PMP22) is a major component of peroxisomal membranes. PMP22 seems to be involved in pore forming activity and may contribute to the unspecific permeability of the organelle membrane.
Gene Description Genome localization
PXMP2 Peroxisomal membrane protein 2 (22 kDa peroxisomal membrane protein). [Source:Uniprot/SWISSPROT;Acc:Q9NR77] [from human gene ENSG00000176876] GeneScaffold_5266: 68932-81014

PXMP2 sequence(s) for Macaca mulatta and PTS predictions

  • PXMP2
    PEX19=0.081; start position=105; end position=114;

  • MAPAASRLRAEAGLGALPRRALAQYLLFLRLYPVLTKAATSGILSALGNFLAQMIEKKRKKEHSRSLDVGGPLRYAVYGFFFTGPLSHFFYLFMEH
    WIPPEVPLAGLRRLLLDRLVFAPAFLMLFFLIMNFLEGKDASAFATKMRGGFWPALRMNWRVWTPVQFININYIPLKFRVLFANLAALFWYAYLAS
    LGK