| Organism : | Neurospora crassa | ||
| Protein family description: | Peroxisomal membrane protein (PMP22) is a major component of peroxisomal membranes. PMP22 seems to be involved in pore forming activity and may contribute to the unspecific permeability of the organelle membrane. | ||
| Gene | Description | Genome localization | |
| NCU02117 | I | ||
PXMP2 sequence(s) for Neurospora crassa and PTS predictions
PEX19=0.079; start position=65; end position=74;
|
|
MLSWYKAQLAARPLLTQAVTTSILFGVGDVAAQQLVDRRGLSNHDLTRTGRMVLYGGAVFGPAATTWFRFLQKRVVVPGSTNKTILARVAADQGLF APTFIGIFLGSMAVLEGTDVKEKLQKNYWEALSTNWMVWPFVQMVNFKVVPLDHRVLFVNVISIGWNCYLSWLNGQFCCLLGSAERHARSFGWE* |