| Organism : | Pan troglodytes | ||
| Protein family description: | Peroxisomal membrane protein (PMP22) is a major component of peroxisomal membranes. PMP22 seems to be involved in pore forming activity and may contribute to the unspecific permeability of the organelle membrane. | ||
| Gene | Description | Genome localization | |
| ENSPTRG00000005655 | NULL | 12: 134731155-134748359 | |
PXMP2 sequence(s) for Pan troglodytes and PTS predictions
PEX19=0.081; start position=105; end position=114;
|
|
MAPAASRLRAEAGLGALPRRALAQYLLFLRLYPVLTKAATSGILSALGNFLAQMIEKKRKKENSRSLDVGGPLRYAVYGFFFTGPLSHFFYFFMEH WIPPEVPLAGLRRLLLDRLVLAPAFLMLFFLIMNFLEGKDASAFAAKMRGGFWPALRMNWRVWTPLQFININYVPLKFRVLFANLAALFWYAYLAS LGK |