| Organism : | Saccharomyces cerevisiae | ||
| Protein family description: | Peroxisomal membrane protein 11 (Peroxin-11) (Peroxisomal biogenesis factor 11) . | ||
| Gene | Description | Genome localization | |
| PEX11 | Peroxisomal membrane protein required for peroxisome proliferation and medium-chain fatty acid oxidation, most abundant protein in the peroxisomal membrane, regulated by Adr1p and Pip2p-Oaf1p, promoter contains ORE and UAS1-like elements. [Source:Saccharo | XV: 47931-48641 | |
PEX11 sequence(s) for Saccharomyces cerevisiae and PTS predictions
PEX19=0.059; start position=32; end position=41;
|
|
MVCDTLVYHPSVTRFVKFLDGSAGREKVLRLLQYLARFLAVQNSSLLARQLQAQFTTVRKFLRFLKPLNHLQAAAKFYDNKLASDNVVRVCNVLKN IFFAAYLSLDQVNLLRILKVIPVTVLTGKKIPRWSNWCWLFGLLSGLAMDLRKIQTSHAQIAAFVKAKSQSQGDEHEDHKKVLGKAYQDRYTALRR LFWDAADSFIVLNNLGYLSSNEEYVALSGVVTSILGMQDMWKAT |