| Organism : | Saccharomyces cerevisiae | ||
| Protein family description: | Peroxisomal membrane protein component of the peroxisomal translocation machinery, required for peroxisome biogenesis, binds Pex14p. | ||
| Gene | Description | Genome localization | |
| PEX17 | Peroxisomal membrane protein component of the peroxisomal translocation machinery, required for peroxisome biogenesis, binds Pex14p. [Source:Saccharomyces Genome Database;Acc:S000005158] | XIV: 245616-246215 | |
PEX17 sequence(s) for Saccharomyces cerevisiae and PTS predictions
PEX19=0.035; start position=77; end position=86;
PEX19=0.037; start position=66; end position=75;
|
|
MTSINSFPRNIDWPSNIGIKKIEGTNPTVNAIKGLLYNGGSIYAFLYFVIAMFVEPTLQKQYQQRNDFSLFVLLRLRRIIAQLQKRLVMTPVSSLG FNEQNNFVERSTQTSDDNIIREDNSHWAEMIYQLQNMKQELQYFNRSSGQPSESIDDFVFQIKMVTDQVELTDRSRAFSNKSRNIIQGIREIKGWF VNGQVPR |