Gene : PEX4

Symbol :	PEX4
Name/description :	PEX4 (PEROXIN4); protein binding / ubiquitin-protein ligase
Synonyms :	F18A17.10, F18A17_10, PEROXIN4, PEX4, UBC21, ubiquitin-conjugating enzyme 21
Organism :	Arabidopsis thaliana
Peroxisomal Localization :	GO: protein import into peroxisome matrix Melanie Zolman, et al.2005. Plant Cell Kazumasa Nito, et al.2007. Plant Cell Physiol. GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	PEX4
Protein consensus sequence :	MQASRARLFKEYKEVQREKVADPDIQLICDDTNIFKWTALIKGPSETPYEGGVFQLAFSVPEPYPLQPPQVRFLTKIFHPNVHFKTGEICLDILKNAWSPAWTLQSVCRAIIALMAHPEPDSPLNCDSGNLLRSGDVRGFNSMAQMYTRLAAMPKKG
Functional category(ies) :	Peroxisome biogenesis (peroxins) Peroxisome matrix protein import
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Blastp PsiBlast Alignment Phylogenetic tree [help] Enzyme reaction data
Gene Info:	Gene Summary (NCBI) Chromosomal Localization (NCBI) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Melanie Lingard, et al.2009. Proc. Natl. Acad. Sci. U.S.A. Peroxisome-associated matrix protein degradation in Arabidopsis. Kazumasa Nito, et al.2007. Plant Cell Physiol. Functional classification of Arabidopsis peroxisome biogenesis factors proposed from analyses of knockdown mutants. Melanie Zolman, et al.2005. Plant Cell Identification and functional characterization of Arabidopsis PEROXIN4 and the interacting protein PEROXIN22.