Symbol : |
PEX12 |
Name/description : |
peroxisomal biogenesis factor 12 |
Synonyms : |
PAF-3 |
Organism : |
|
Peroxisomal Localization : |
- GO: peroxisome
- GFP: No experiment found
- Mass Spectrometry: No experiment found
- PeroxisomeDB annotation
|
Protein family : |
|
Protein consensus sequence : |
PEX19=0.046; start position=114; end position=123;
PEX19=0.058; start position=59; end position=68;
PEX19=0.078; start position=252; end position=261;
MAEHGAHFTAASVADDQPSIFEVVAQDSLMTAVRPALQHVVKVLAESNPTHYGFLWRWFDEIFTLLDLLLQQHYLSRTSASFSENFYGLKRIVMGDTHKSQRLASAGLPKQQLWKSIMFLVLLPYLKVKLEKLVSSLREEDEYSIHPPSSRWKRFYRAFLAAYPFVNMAWEGWFLVQQLRYILGKAQHHSPLLRLAGVQLGRLTVQDIQALEHKPAKASMMQQPARSVSEKINSALKKAVGGVALSLSTGLSVGVFFLQFLDWWYSSENQETIKSLTALPTPPPPVHLDYNSDSPLLPKMKTVCPLCRKTRVNDTVLATSGYVFCYRCVFHYVRSHQACPITGYPTEVQHLIKLYSPEN |
Functional category(ies) : |
|
Disease(s) : |
|
Comparative genomics: |
|
Gene Info: |
|
Pubmed: |
- Avraham Zeharia, et al.2007. J. Hum. Genet. A novel PEX12 mutation identified as the cause of a peroxisomal biogenesis disorder with mild clinical phenotype, mild biochemical abnormalities in fibroblasts and a mosaic catalase immunofluorescence pattern, even at 40 degrees C.
- Cindy Krause, et al.2006. Hum. Mutat. Identification of novel mutations in PEX2, PEX6, PEX10, PEX12, and PEX13 in Zellweger spectrum patients.
- Jeannette Gootjes, et al.2004. Hum. Mutat. Identification of the molecular defect in patients with peroxisomal mosaicism using a novel method involving culturing of cells at 40 degrees C: implications for other inborn errors of metabolism.
- J Gootjes, et al.2004. Neurology Reinvestigation of trihydroxycholestanoic acidemia reveals a peroxisome biogenesis disorder.
- Jeannette Gootjes, et al.2004. Eur. J. Hum. Genet. Novel mutations in the PEX12 gene of patients with a peroxisome biogenesis disorder.
- Harper Harper, et al.2003. J. Biol. Chem. PEX5 binds the PTS1 independently of Hsp70 and the peroxin PEX12.
- Masanori Honsho, et al.2002. J. Biol. Chem. The membrane biogenesis peroxin Pex16p. Topogenesis and functional roles in peroxisomal membrane assembly.
|