Gene : PEX10

Symbol :	PEX10
Name/description :	peroxisome biogenesis factor 10
Synonyms :	NALD, RNF69, MGC1998
Organism :	Homo sapiens
Peroxisomal Localization :	GO: peroxisome D Warren, et al.1998. Am. J. Hum. Genet. K Okumoto, et al.1998. Hum. Mol. Genet. South South, et al.1999. J. Cell Biol. GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	PEX10
Protein consensus sequence :	PEX19=0.047; start position=239; end position=248; MAPAAASPPEVIRAAQKDEYYRGGLRSAAGGALHSLAGARKWLEWRKEVELLSDVAYFGLTTLAGYQTLGEEYVSIIQVDPSRIHVPSSLRRGVLVTLHAVLPYLLDKALLPLEQELQADPDSGRPLQGSLGPGGRGCSGARRWMRHHTATLTEQQRRALLRAVFVLRQGLACLQRLHVAWFYIHGVFYHLAKRLTGITYQALRPDPLRVLMSVAPSALQLRVRSLPGEDLRARVSYRLLGVISLLHLVLSMGLQLYGFRQRQRARKEWRLHRGLSHRRASLEERAVSRNPLCTLCLEERRHPTATPCGHLFCWECITAWCSSKAECPLCREKFPPQKLIYLRHYR
Functional category(ies) :	Peroxisome matrix protein import ZN RING proteins
Disease(s) :	Zellweger syndrome Neonatal adrenoleukodystrophy Infantile Refsum disease
Comparative genomics:	PTS prediction Blastp PsiBlast Alignment Phylogenetic tree [help] PhylomeDB
Gene Info:	Gene Summary (NCBI) Genome Browser (UCSC) Chromosomal Localization (NCBI) ENSEMBL SNPs (NCBI) Intron/Exon (Ace View: NCBI) Gene Expression (UCSC) Protein Properties (UCSC) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Yik Yik, et al.2009. Hum. Mutat. Identification of novel mutations and sequence variation in the Zellweger syndrome spectrum of peroxisome biogenesis disorders. Cindy Krause, et al.2006. Hum. Mutat. Identification of novel mutations in PEX2, PEX6, PEX10, PEX12, and PEX13 in Zellweger spectrum patients. Warren Warren, et al.2000. Hum. Mutat. Phenotype-genotype relationships in PEX10-deficient peroxisome biogenesis disorder patients. Chang Chang, et al.1999. J. Cell Biol. PEX12 interacts with PEX5 and PEX10 and acts downstream of receptor docking in peroxisomal matrix protein import. S Chang, et al.1999. J. Cell. Sci. Metabolic control of peroxisome abundance.