Symbol : |
PXMP3 |
Name/description : |
peroxin 2 |
Synonyms : |
PAF1, PEX2, PMP3, PAF-1, PMP35, RNF72 |
Organism : |
|
Peroxisomal Localization : |
- GO: integral to peroxisomal membrane
- GFP: No experiment found
- Mass Spectrometry: No experiment found
- PeroxisomeDB annotation
|
Protein family : |
|
Protein consensus sequence : |
PEX19=0.0019; start position=201; end position=210;
PEX19=0.0088; start position=149; end position=158;
PEX19=0.015; start position=139; end position=148;
MASRKENAKSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVKACLWVFLWRFTIYSKNATVGQSVLNIKYKNDFSPNLRYQPPSKNQKIWYAVCTIGGRWLEERCYDLFRNHHLASFGKVKQCVNFVIGLLKLGGLINFLIFLQRGKFATLTERLLGIHSVFCKPQNICEVGFEYMNRELLWHGFAEFLIFLLPLINVQKLKAKLSSWCIPLTGAPNSDNTLATSGKECALCGEWPTMPHTIGCEHIFCYFCAKSSFLFDVYFTCPKCGTEVHSLQPLKSGIEMSEVNAL |
Functional category(ies) : |
|
Disease(s) : |
|
Comparative genomics: |
|
Gene Info: |
|
Pubmed: |
- Cindy Krause, et al.2006. Hum. Mutat. Identification of novel mutations in PEX2, PEX6, PEX10, PEX12, and PEX13 in Zellweger spectrum patients.
- Jeannette Gootjes, et al.2004. Pediatr. Res. Novel mutations in the PEX2 gene of four unrelated patients with a peroxisome biogenesis disorder.
- C Fujiwara, et al.2000. J. Biol. Chem. Catalase-less peroxisomes. Implication in the milder forms of peroxisome biogenesis disorder.
- M Ito, et al.2000. Biochim. Biophys. Acta Rapid isolation and characterization of CHO mutants deficient in peroxisome biogenesis using the peroxisomal forms of fluorescent proteins.
- S Chang, et al.1999. J. Cell. Sci. Metabolic control of peroxisome abundance.
- G Dodt, et al.1996. J. Cell Biol. Multiple PEX genes are required for proper subcellular distribution and stability of Pex5p, the PTS1 receptor: evidence that PTS1 protein import is mediated by a cycling receptor.
|