Gene : PEX18

Symbol :	PEX18
Name/description :	Peroxin required for targeting of peroxisomal matrix proteins containing PTS2; interacts with Pex7p; partially redundant with Pex21p Pex18p
Synonyms :
Organism :	Saccharomyces cerevisiae
Peroxisomal Localization :	GO: peroxisome X Purdue, et al.1998. J. Cell Biol. GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	PEX18-21
Protein consensus sequence :	MNSNRCQTNEVNKFISSTEKGPFTGRDNTLSFNKIGSRLNSPPILKDKIELKFLQHSEDLNQSRSYVNIRPRTLEDQSYKFEAPNLNDNETSWAKDFRYNFPKNVEPPIENQIANLNINNGLRTSQTDFPLGFYSQKNFNIASFPVVDHQIFKTTGLEHPINSHIDSLINAEFSELEASSLEEDVHTEEENSGTSLEDEETAMKGLASDIIEFCDNNSANKDVKERLNSSKFMGLMGSISDGSIVLKKDNGTERNLQKHVGFCFQNSGNWAGLEFHDVEDRIA
Functional category(ies) :	Peroxisome biogenesis (peroxins) Peroxisome targeting sequence binding
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Blastp PsiBlast Alignment Phylogenetic tree [help] PhylomeDB
Gene Info:	Gene Summary (NCBI) Genome Browser (UCSC) Chromosomal Localization (NCBI) ENSEMBL Protein Properties (UCSC) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Silke Grunau, et al.2009. Traffic Peroxisomal targeting of PTS2 pre-import complexes in the yeast Saccharomyces cerevisiae. H Einwächter, et al.2001. EMBO Rep. Yarrowia lipolytica Pex20p, Saccharomyces cerevisiae Pex18p/Pex21p and mammalian Pex5pL fulfil a common function in the early steps of the peroxisomal PTS2 import pathway. Purdue Purdue, et al.2001. J. Biol. Chem. Pex18p is constitutively degraded during peroxisome biogenesis. G Dodt, et al.2001. J. Biol. Chem. Domain mapping of human PEX5 reveals functional and structural similarities to Saccharomyces cerevisiae Pex18p and Pex21p. X Purdue, et al.1998. J. Cell Biol. Pex18p and Pex21p, a novel pair of related peroxins essential for peroxisomal targeting by the PTS2 pathway.