| Symbol : |
PEX15 |
| Name/description : |
Pex15p
Phosphorylated tail-anchored type II integral peroxisomal membrane protein required for peroxisome biogenesis, cells lacking Pex15p mislocalize peroxisomal matrix proteins to cytosol, overexpression result |
| Synonyms : |
PAS21 |
| Organism : |
|
| Peroxisomal Localization : |
- GO: integral to peroxisomal membrane
- GFP: No experiment found
- Mass Spectrometry:
- PeroxisomeDB annotation
|
| Protein family : |
|
| Protein consensus sequence : |
PEX19=0.0012; start position=136; end position=145;
PEX19=0.016; start position=337; end position=346;
PEX19=0.058; start position=340; end position=349;
PEX19=0.066; start position=370; end position=379;
MAASEIMNNLPMHSLDSSLRDLLNDDLFIESDESTKSVNDQRSEVFQECVNLFIKRDIKDCLEKMSEVGFIDITVFKSNPMILDLFVSACDIMPSFTKLGLTLQSEILNIFTLDTPQCIETRKIILGDLSKLLVINKFFRCCIKVIQFNLTDHTEQEEKTLELESIMSDFIFVYITKMRTTIDVVGLQELIEIFIFQVKVKLHHKKPSPNMYWALCKTLPKLSPTLKGLYLSKDVSIEDAILNSIDNKIQKDKAKSKGKQRGVKQKIHHFHEPMLHNSSEEQVKVEDAFNQRTSTDSRLQSTGTAPRKKNNDITVLAGSFWAVLKHHFTRSVLNKNGLLLTGLLLLLCLKKYKSLMAIFKHVPAAFHTVYPQIVGLLKLLASI |
| Functional category(ies) : |
|
| Disease(s) : |
No diseases found
|
| Comparative genomics: |
|
| Gene Info: |
|
| Pubmed: |
|