Gene : PEX11

Symbol :	PEX11
Name/description :	Peroxisomal membrane protein required for peroxisome proliferation and medium-chain fatty acid oxidation, most abundant protein in the peroxisomal membrane, regulated by Adr1p and Pip2p-Oaf1p, promoter contains ORE and UAS1-like elements
Synonyms :	PMP27, PMP24
Organism :	Saccharomyces cerevisiae
Peroxisomal Localization :	GO: peroxisomal membrane R Erdmann, et al.1995. J. Cell Biol. GFP: Klaus Natter, et al.2005. Mol. Cell PROTEOMICS Won-Ki Huh, et al.2003. Nature Marcello Yi, et al.2002. Electrophoresis Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	PEX11
Protein consensus sequence :	PEX19=0.059; start position=32; end position=41; MVCDTLVYHPSVTRFVKFLDGSAGREKVLRLLQYLARFLAVQNSSLLARQLQAQFTTVRKFLRFLKPLNHLQAAAKFYDNKLASDNVVRVCNVLKNIFFAAYLSLDQVNLLRILKVIPVTVLTGKKIPRWSNWCWLFGLLSGLAMDLRKIQTSHAQIAAFVKAKSQSQGDEHEDHKKVLGKAYQDRYTALRRLFWDAADSFIVLNNLGYLSSNEEYVALSGVVTSILGMQDMWKAT
Functional category(ies) :	Peroxisome biogenesis (peroxins) Peroxisome division-proliferation
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Blastp PsiBlast Alignment Phylogenetic tree [help] PhylomeDB
Gene Info:	Gene Summary (NCBI) Genome Browser (UCSC) Chromosomal Localization (NCBI) ENSEMBL Protein Properties (UCSC) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Travis Orth, et al.2007. Plant Cell The PEROXIN11 protein family controls peroxisome proliferation in Arabidopsis. Marcello Tam, et al.2003. Mol. Biol. Cell Pex11-related proteins in peroxisome dynamics: a role for the novel peroxin Pex27p in controlling peroxisome size and number in Saccharomyces cerevisiae. Vizeacoumar Vizeacoumar, et al.2003. J. Cell Biol. YHR150w and YDR479c encode peroxisomal integral membrane proteins involved in the regulation of peroxisome number, size, and distribution in Saccharomyces cerevisiae. Xiaoling Li, et al.2003. J. Biol. Chem. The dynamin-like GTPase DLP1 is essential for peroxisome division and is recruited to peroxisomes in part by PEX11. Hanspeter Rottensteiner, et al.2003. Mol. Biol. Cell Conserved function of pex11p and the novel pex25p and pex27p in peroxisome biogenesis.