Gene : PEX19

Symbol :	PEX19
Name/description :	peroxisomal biogenesis factor 19
Synonyms :	PXF, HK33, PMP1, PMPI, PXMP1, D1S2223E, FLJ55296
Organism :	Homo sapiens
Peroxisomal Localization :	GO: peroxisomal membrane S Kammerer, et al.1997. Genomics X Sacksteder, et al.2000. J. Cell Biol. GFP: No experiment found Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	PEX19
Protein consensus sequence :	MAAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNATDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNLSGPPGASGEQCLIM
Functional category(ies) :	Peroxisome biogenesis (peroxins) Peroxisome membrane assembly
Disease(s) :	Zellweger syndrome
Comparative genomics:	PTS prediction Blastp PsiBlast Alignment Phylogenetic tree [help] PhylomeDB
Gene Info:	Gene Summary (NCBI) Genome Browser (UCSC) Chromosomal Localization (NCBI) ENSEMBL SNPs (NCBI) Intron/Exon (Ace View: NCBI) Gene Expression (UCSC) Protein Properties (UCSC) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	Yasuhiko Sato, et al.2008. J. Biol. Chem. Characterization of the interaction between recombinant human peroxin Pex3p and Pex19p: identification of TRP-104 IN Pex3p as a critical residue for the interaction. Hiroyuki Shibata, et al.2004. J. Biol. Chem. Domain architecture and activity of human Pex19p, a chaperone-like protein for intracellular trafficking of peroxisomal membrane proteins. Marc Fransen, et al.2004. J. Biol. Chem. Potential role for Pex19p in assembly of PTS-receptor docking complexes. Jones Jones, et al.2004. J. Cell Biol. PEX19 is a predominantly cytosolic chaperone and import receptor for class 1 peroxisomal membrane proteins. Jones Jones, et al.2001. J. Cell Biol. Multiple distinct targeting signals in integral peroxisomal membrane proteins.