Gene : PNC1

Symbol :	PNC1
Name/description :	Nicotinamidase that converts nicotinamide to nicotinic acid as part of the NAD(+) salvage pathway, required for life span extension by calorie restriction; PNC1 expression responds to all known stimuli that extend replicative life span
Synonyms :
Organism :	Saccharomyces cerevisiae
Peroxisomal Localization :	GO: peroxisome Oliver Anderson, et al.2003. Nature GFP: Won-Ki Huh, et al.2003. Nature Mass Spectrometry: No experiment found PeroxisomeDB annotation
Protein family :	PNC1
Protein consensus sequence :	MKTLIVVDMQNDFISPLGSLTVPKGEELINPISDLMQDADRDWHRIVVTRDWHPSRHISFAKNHKDKEPYSTYTYHSPRPGDDSTQEGILWPVHCVKNTWGSQLVDQIMDQVVTKHIKIVDKGFLTDREYYSAFHDIWNFHKTDMNKYLEKHHTDEVYIVGVALEYCVKATAISAAELGYKTTVLLDYTRPISDDPEVINKVKEELKAHNINVVDK
Functional category(ies) :	Metabolism Nicotinate and nicotinamide metabolism
Disease(s) :	No diseases found
Comparative genomics:	PTS prediction Blastp PsiBlast Alignment Phylogenetic tree [help] PhylomeDB Enzyme reaction data
Gene Info:	Gene Summary (NCBI) Genome Browser (UCSC) Chromosomal Localization (NCBI) ENSEMBL Protein Properties (UCSC) Conserved Domains (NCBI) Orthologue Prediction (NCBI)
Pubmed:	No references found